PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG815600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 315aa    MW: 34248.5 Da    PI: 4.6275
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG815600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.37.2e-2066119356
                          --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          k++++ ++q+++Le++Fe +++++ +++ ++A+ lgL+ rqV vWFqNrRa++k
  Pavir.9NG815600.1.p  66 KKRRLAADQVRALERCFETDNKLDPDRKSRIARDLGLQPRQVAVWFQNRRARWK 119
                          4557899**********************************************9 PP

2HD-ZIP_I/II126.11.6e-4065157193
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          ekkrrl+++qv++LE++Fe+++kL+p+rK+++ar+LglqprqvavWFqnrRAR+ktk lE+d++aL+++++al+++ ++L++++++L++e
  Pavir.9NG815600.1.p  65 EKKRRLAADQVRALERCFETDNKLDPDRKSRIARDLGLQPRQVAVWFQNRRARWKTKTLERDFAALRARHEALRADCDALRRDKDALAAE 154
                          69**************************************************************************************99 PP

          HD-ZIP_I/II  91 lke 93 
                          ++e
  Pavir.9NG815600.1.p 155 IRE 157
                          986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.91E-1859121IPR009057Homeodomain-like
SMARTSM003891.7E-1964125IPR001356Homeobox domain
PROSITE profilePS5007116.47165121IPR001356Homeobox domain
PfamPF000464.7E-1766119IPR001356Homeobox domain
CDDcd000861.25E-1666121No hitNo description
Gene3DG3DSA:1.10.10.602.8E-2072120IPR009057Homeodomain-like
PRINTSPR000314.2E-592101IPR000047Helix-turn-helix motif
PROSITE patternPS00027096119IPR017970Homeobox, conserved site
PRINTSPR000314.2E-5101117IPR000047Helix-turn-helix motif
PfamPF021833.3E-13121162IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MKRQSKRPAS SHESTEEGEK LAVALDEALT ARNMEHEEAE LDDVNDDDDE LAGGRSARSP  60
CGLGEKKRRL AADQVRALER CFETDNKLDP DRKSRIARDL GLQPRQVAVW FQNRRARWKT  120
KTLERDFAAL RARHEALRAD CDALRRDKDA LAAEIRELRQ KLSKPEAAAK LEAAANDSAE  180
ERQATVGASA AAICKDGSSD SDSSVVFNDV EASPYSGAAF EQTAFAGFGP PFLDTSAATT  240
TGCSPLSMFE TKWQQAPAYP YDSYKNGGGY GFTEEWLASS DVIGSGDGAA SFFSEEHASS  300
LNFGWCASGT EAWE*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.201820.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX4699250.0JX469925.1 Zea mays subsp. mays clone UT3181 HB-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985408.11e-170PREDICTED: homeobox-leucine zipper protein HOX13-like
SwissprotQ10QP31e-107HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLK4ACW71e-170K4ACW7_SETIT; Uncharacterized protein
STRINGSi036724m1e-169(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.11e-29homeobox protein 16